PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v3992540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WOX
Protein Properties Length: 282aa    MW: 30729.3 Da    PI: 6.5115
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v3992540.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox482.1e-153393257
                     T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                     r+R+t+++eq+ +Le+ F++   +p ++e  ++ k l     + +++V++WFqNrR + ++
  Lj1g3v3992540.1 33 RSRWTPKPEQILILESIFNSgMVNPPKDETVRIRKLLekfgTVGDANVFYWFQNRRSRSRR 93
                     89*****************99*************************************997 PP

2Wus_type_Homeobox107.11e-343295265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +r+RWtP+peQi iLe++++sG+++P+k+e+ ri++ Le++G ++d+NVfyWFQNr++R+r++q
    Lj1g3v3992540.1 32 VRSRWTPKPEQILILESIFNSGMVNPPKDETVRIRKLLEKFGTVGDANVFYWFQNRRSRSRRRQ 95
                       589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-81394IPR009057Homeodomain-like
SuperFamilySSF466892.91E-1428100IPR009057Homeodomain-like
PROSITE profilePS5007111.2562994IPR001356Homeobox domain
SMARTSM003898.3E-73198IPR001356Homeobox domain
PfamPF000464.0E-133393IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048830Biological Processadventitious root development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MEDHQGQKDP NTKNNNAPSP HHGCSSEKSE PVRSRWTPKP EQILILESIF NSGMVNPPKD  60
ETVRIRKLLE KFGTVGDANV FYWFQNRRSR SRRRQRQMQA SLVEQRNNLQ NNNMQQQLLE  120
GAPAAASAIP CDQAQGHPNL AAAISMGFGS SSSPSYLAGS SSSCGVGQQG LDGYFSLSPQ  180
MGYPGIDQSF AASSLVYPPV APNLNYQSGY EGSNVSGYIT VFINGIATEL QGGLIDMKTM  240
FGEDVMLVHS SGVPVPTNEF GFLMQSLQHG ESYILVPKAP QE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150449e-71AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012569212.11e-106PREDICTED: WUSCHEL-related homeobox 11 isoform X1
SwissprotQ8GY255e-67WOX12_ARATH; WUSCHEL-related homeobox 12
TrEMBLB7FL743e-97B7FL74_MEDTR; Uncharacterized protein
STRINGGLYMA19G29660.21e-95(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58983152
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17810.24e-35WUSCHEL related homeobox 12